Lineage for d3v4xa2 (3v4x A:168-383)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2916988Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species)
    most similar to FabH
  7. 2916989Species Enterococcus faecalis [TaxId:1351] [419511] (4 PDB entries)
  8. 2916994Domain d3v4xa2: 3v4x A:168-383 [217656]
    Other proteins in same PDB: d3v4xa1, d3v4xa3, d3v4xb1, d3v4xb3, d3v4xc1, d3v4xc3, d3v4xd1, d3v4xd3
    automated match to d1xpma2
    complexed with f24

    has additional subdomain(s) that are not in the common domain

Details for d3v4xa2

PDB Entry: 3v4x (more details), 1.95 Å

PDB Description: The Biochemical and Structural Basis for Inhibition of Enterococcus faecalis HMG-CoA Synthase, mvaS, by Hymeglusin
PDB Compounds: (A:) HMG-CoA synthase

SCOPe Domain Sequences for d3v4xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4xa2 c.95.1.2 (A:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn

SCOPe Domain Coordinates for d3v4xa2:

Click to download the PDB-style file with coordinates for d3v4xa2.
(The format of our PDB-style files is described here.)

Timeline for d3v4xa2: