| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species) most similar to FabH |
| Species Enterococcus faecalis [TaxId:1351] [419511] (4 PDB entries) |
| Domain d3v4nc2: 3v4n C:168-383 [217644] Other proteins in same PDB: d3v4na1, d3v4na3, d3v4nb1, d3v4nb3, d3v4nc1, d3v4nd1 automated match to d1xpma2 complexed with btb has additional subdomain(s) that are not in the common domain |
PDB Entry: 3v4n (more details), 1.6 Å
SCOPe Domain Sequences for d3v4nc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4nc2 c.95.1.2 (C:168-383) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Enterococcus faecalis [TaxId: 1351]}
ilalkednvmltqdiydfwrptghpypmvdgplsnetyiqsfaqvwdehkkrtgldfady
dalafhipytkmgkkallakisdqteaeqerilaryeesiiysrrvgnlytgslylglis
llenattltagnqiglfsygsgavaefftgelvagyqnhlqkethlalldnrtelsiaey
eamfaetldtdidqtledelkysisainntvrsyrn
Timeline for d3v4nc2: