SCOPe 2.06: Domain d1f97a2: 1f97 A:129-238

Lineage for d1f97a2 (1f97 A:129-238)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49187] (1 PDB entry)

8. Domain d1f97a2: 1f97 A:129-238 [21764]
   Other proteins in same PDB: d1f97a1
   complexed with mg

Details for d1f97a2

PDB Entry: 1f97, 2.5 Å

PDB Description: soluble part of the junction adhesion molecule from mouse

PDB Compounds: (A:) junction adhesion molecule

SCOPe Domain Sequences for d1f97a2:

Sequence, based on SEQRES records:

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismltadakktrafmnssf
tidpksgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

Sequence, based on observed residues (ATOM records):

>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vppskptisvpssvtignravltcsehdgsppseyswfkdgismlttrafmnssftidpk
sgdlifdpvtafdsgeyycqaqngygtamrseaahmdavelnvgg

Timeline for d1f97a2:

• d1f97a2 first appeared (with stable ids) in SCOP 1.55
  
• d1f97a2 appears in SCOPe 2.05
  
• d1f97a2 appears in SCOPe 2.07
  
• d1f97a2 appears in the current release, SCOPe 2.08