Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) |
Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS [110760] (2 species) most similar to FabH |
Species Enterococcus faecalis [TaxId:1351] [225034] (4 PDB entries) |
Domain d3v4na1: 3v4n A:1-167 [217639] Other proteins in same PDB: d3v4na3, d3v4nb3 automated match to d1tvza1 complexed with btb |
PDB Entry: 3v4n (more details), 1.6 Å
SCOPe Domain Sequences for d3v4na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4na1 c.95.1.2 (A:1-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Enterococcus faecalis [TaxId: 1351]} mtigidkisffvppyyidmtalaearnvdpgkfhigigqdqmavnpisqdivtfaanaae ailtkedkeaidmvivgtessideskaaavvlhrlmgiqpfarsfeikeacygataglql aknhvalhpdkkvlvvaadiakyglnsggeptqgagavamlvssepr
Timeline for d3v4na1: