SCOPe 2.05: Domain d3v4hb_: 3v4h B:

Lineage for d3v4hb_ (3v4h B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.157: Hcp1-like [141451] (1 superfamily)
   barrel, closed; n=6, S=12; contains extra, non-barrel strand 7 at the C-terminus

4. Superfamily b.157.1: Hcp1-like [141452] (2 families)
   probable biological unit is a ring-like hexamer containing a 24-stranded beta-barrel made of the subunit beta-sheets

5. Family b.157.1.0: automated matches [191591] (1 protein)
   not a true family

6. Protein automated matches [191065] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226275] (1 PDB entry)

8. Domain d3v4hb_: 3v4h B: [217638]
   automated match to d1y12a1

Details for d3v4hb_

PDB Entry: 3v4h, 2.1 Å

PDB Description: crystal structure of a type vi secretion system effector from yersinia pestis

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d3v4hb_:

Sequence, based on SEQRES records:

>d3v4hb_ b.157.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
dmfikidgiegesldanhkneiqvlawnwdvaqhsnmhsgsgggsgkasvsdfcfahyid
kaspnllsycllgkhiknvqfvlrkaggdpleyltikftdviitrvdmagsledetrpre
eirfsftkmtqdyvmqnaeghksgvisanydv

Sequence, based on observed residues (ATOM records):

>d3v4hb_ b.157.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
dmfikidgiegesldanhkneiqvlawnwdvaqkasvsdfcfahyidkaspnllsycllg
khiknvqfvlrkapleyltikftdviitrvdmagsletrpreeirfsftkmtqdyvmqks
gvisanydv

Timeline for d3v4hb_:

• d3v4hb_ first appeared in SCOPe 2.03
  
• d3v4hb_ appears in SCOPe 2.04
  
• d3v4hb_ appears in SCOPe 2.06
  
• d3v4hb_ appears in the current release, SCOPe 2.08