Lineage for d3v3qa1 (3v3q A:30-267)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008847Protein Orphan nuclear receptor NR4A1 [158811] (1 species)
  7. 2008848Species Human (Homo sapiens) [TaxId:9606] [158812] (15 PDB entries)
    Uniprot P22736 363-595
  8. 2008851Domain d3v3qa1: 3v3q A:30-267 [217631]
    Other proteins in same PDB: d3v3qa2, d3v3qb2
    automated match to d3v3ea_
    complexed with gol, na, tmy

Details for d3v3qa1

PDB Entry: 3v3q (more details), 2.22 Å

PDB Description: Crystal Structure of Human Nur77 Ligand-binding Domain in Complex with Ethyl 2-[2,3,4 trimethoxy-6(1-octanoyl)phenyl]acetate
PDB Compounds: (A:) Nuclear receptor subfamily 4 group A member 1

SCOPe Domain Sequences for d3v3qa1:

Sequence, based on SEQRES records: (download)

>d3v3qa1 a.123.1.1 (A:30-267) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
avagepqpasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

Sequence, based on observed residues (ATOM records): (download)

>d3v3qa1 a.123.1.1 (A:30-267) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]}
panlltslvrahldsgpstakldyskfqelvlphfgkedagdvqqfydllsgslevirkw
aekipgfaelspadqdlllesaflelfilrlayrskpgegklifcsglvlhrlqcargfg
dwidsilafsrslhsllvdvpafaclsalvlitdrhglqeprrveelqnriasclkehva
avapasclsrllgklpelrtlctqglqrifylkledlvppppiidkifmdtlpf

SCOPe Domain Coordinates for d3v3qa1:

Click to download the PDB-style file with coordinates for d3v3qa1.
(The format of our PDB-style files is described here.)

Timeline for d3v3qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v3qa2