SCOPe 2.01: Domain d1cs6a4: 1cs6 A:300-388

Lineage for d1cs6a4 (1cs6 A:300-388)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Axonin-1 [49184] (1 species)
   tandem repeat of 4 L1 domains

7. Species Chicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)

8. Domain d1cs6a4: 1cs6 A:300-388 [21763]
   complexed with gol

Details for d1cs6a4

PDB Entry: 1cs6, 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken

PDB Compounds: (A:) axonin-1

SCOPe Domain Sequences for d1cs6a4:

Sequence; same for both SEQRES and ATOM records:

>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]}
qpdwldvitdteadigsdlrwscvasgkprpavrwlrdgqplasqnrievsggelrfskl
vledsgmyqcvaenkhgtvyasaeltvqa

Timeline for d1cs6a4:

• d1cs6a4 first appeared (with stable ids) in SCOP 1.55
  
• d1cs6a4 appears in SCOP 1.75
  
• d1cs6a4 appears in SCOPe 2.02
  
• d1cs6a4 appears in the current release, SCOPe 2.08