Lineage for d3v2rb_ (3v2r B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1708735Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family) (S)
  5. 1708736Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)
  6. 1708737Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
    pentameric coiled-coil
  7. 1708738Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)
  8. 1708765Domain d3v2rb_: 3v2r B: [217623]
    automated match to d1mz9a_
    complexed with ola

Details for d3v2rb_

PDB Entry: 3v2r (more details), 2.75 Å

PDB Description: COMPcc in complex with fatty acids
PDB Compounds: (B:) Cartilage Oligomerization matrix protein (coiled-coil domain)

SCOPe Domain Sequences for d3v2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v2rb_ h.1.7.1 (B:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

SCOPe Domain Coordinates for d3v2rb_:

Click to download the PDB-style file with coordinates for d3v2rb_.
(The format of our PDB-style files is described here.)

Timeline for d3v2rb_: