SCOPe 2.07: Domain d3v2nb_: 3v2n B:

Lineage for d3v2nb_ (3v2n B:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.7: Assembly domain of cartilage oligomeric matrix protein [58006] (1 family)

5. Family h.1.7.1: Assembly domain of cartilage oligomeric matrix protein [58007] (1 protein)

6. Protein Assembly domain of cartilage oligomeric matrix protein [58008] (1 species)
   pentameric coiled-coil

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [58009] (7 PDB entries)

8. Domain d3v2nb_: 3v2n B: [217608]
   automated match to d1mz9a_
   complexed with myr

Details for d3v2nb_

PDB Entry: 3v2n, 1.8 Å

PDB Description: COMPcc in complex with fatty acids

PDB Compounds: (B:) Cartilage Oligomerization matrix protein (coiled-coil domain)

SCOPe Domain Sequences for d3v2nb_:

Sequence; same for both SEQRES and ATOM records:

>d3v2nb_ h.1.7.1 (B:) Assembly domain of cartilage oligomeric matrix protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdlapqmlrelqetnaalqdvrellrqqvkeitflkntvmecdac

Timeline for d3v2nb_:

• d3v2nb_ first appeared in SCOPe 2.03
  
• d3v2nb_ appears in SCOPe 2.06
  
• d3v2nb_ appears in the current release, SCOPe 2.08