Lineage for d3v2la_ (3v2l A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1269819Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1269907Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 1269908Protein automated matches [191085] (6 species)
    not a true protein
  7. 1269909Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (4 PDB entries)
  8. 1269914Domain d3v2la_: 3v2l A: [217606]
    automated match to d4f7fd_
    complexed with pg4

Details for d3v2la_

PDB Entry: 3v2l (more details), 1.8 Å

PDB Description: Structure of Anopheles gambiae odorant binding protein 20 bound to polyethylene glycol
PDB Compounds: (A:) agap005208-pa

SCOPe Domain Sequences for d3v2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v2la_ a.39.2.0 (A:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
mtveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgk
lnydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp

SCOPe Domain Coordinates for d3v2la_:

Click to download the PDB-style file with coordinates for d3v2la_.
(The format of our PDB-style files is described here.)

Timeline for d3v2la_: