SCOPe 2.08: Domain d3v2la1: 3v2l A:2-120

Lineage for d3v2la1 (3v2l A:2-120)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (10 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [193461] (7 PDB entries)

8. Domain d3v2la1: 3v2l A:2-120 [217606]
   Other proteins in same PDB: d3v2la2
   automated match to d4f7fd_
   complexed with pg4

Details for d3v2la1

PDB Entry: 3v2l, 1.8 Å

PDB Description: Structure of Anopheles gambiae odorant binding protein 20 bound to polyethylene glycol

PDB Compounds: (A:) agap005208-pa

SCOPe Domain Sequences for d3v2la1:

Sequence; same for both SEQRES and ATOM records:

>d3v2la1 a.39.2.0 (A:2-120) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
tveqmmksgemirsvclgktkvaeelvnglreskfadvkelkcyvncvmemmqtmkkgkl
nydasvkqidtimpdelagpmraaldicrtvadgiknncdaayvllqclsknnpkfifp

Timeline for d3v2la1:

• d3v2la1 first appeared in SCOPe 2.03, called d3v2la_
  
• d3v2la1 appears in SCOPe 2.07