SCOPe 2.05: Domain d3v20b_: 3v20 B:

Lineage for d3v20b_ (3v20 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins)
   automatically mapped to Pfam PF07832

6. Protein Restriction endonuclease Bse634I [69523] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries)

8. Domain d3v20b_: 3v20 B: [217603]
   automated match to d3v21c_
   protein/DNA complex; complexed with 7pe, ca, cl

Details for d3v20b_

PDB Entry: 3v20, 2.35 Å

PDB Description: crystal structure of type iif restriction endonuclease bse634i with cognate dna

PDB Compounds: (B:) Endonuclease Bse634IR

SCOPe Domain Sequences for d3v20b_:

Sequence; same for both SEQRES and ATOM records:

>d3v20b_ c.52.1.7 (B:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]}
ltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgla
iptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrekl
hqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdieg
kckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygassepv
skadddalqtaathtivnvnstperavddifsltsfedidkmldqiik

Timeline for d3v20b_:

• d3v20b_ first appeared in SCOPe 2.03
  
• d3v20b_ appears in SCOPe 2.04
  
• d3v20b_ appears in SCOPe 2.06
  
• d3v20b_ appears in the current release, SCOPe 2.08