![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins) automatically mapped to Pfam PF07832 |
![]() | Protein Restriction endonuclease Bse634I [69523] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries) |
![]() | Domain d3v1za_: 3v1z A: [217600] automated match to d3v21h_ protein/DNA complex |
PDB Entry: 3v1z (more details), 2.2 Å
SCOPe Domain Sequences for d3v1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v1za_ c.52.1.7 (A:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]} tnltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakg laiptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetre klhqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdi egkckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygasse pvskadddalqtaathtivnvnstperavddifsltsfedidkmldqiik
Timeline for d3v1za_: