Lineage for d1cs6a1 (1cs6 A:7-103)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54282Protein Axonin-1 [49184] (1 species)
  7. 54283Species Ckicken (Gallus gallus) [TaxId:9031] [49185] (1 PDB entry)
  8. 54284Domain d1cs6a1: 1cs6 A:7-103 [21760]

Details for d1cs6a1

PDB Entry: 1cs6 (more details), 1.8 Å

PDB Description: n-terminal fragment of axonin-1 from chicken

SCOP Domain Sequences for d1cs6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Ckicken (Gallus gallus)}
rsygpvfeeqpahtlfpegsaeekvtltcraranppatyrwkmngtelkmgpdsryrlva
gdlvisnpvkakdagsyqcvatnargtvvsreaslrf

SCOP Domain Coordinates for d1cs6a1:

Click to download the PDB-style file with coordinates for d1cs6a1.
(The format of our PDB-style files is described here.)

Timeline for d1cs6a1: