Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.3: Calsequestrin [52855] (1 protein) duplication: contains three tandem repeats of this fold |
Protein Calsequestrin [52856] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (3 PDB entries) |
Domain d3v1wa2: 3v1w A:127-228 [217598] automated match to d1a8ya2 complexed with ca, mpd, mrd, na |
PDB Entry: 3v1w (more details), 1.91 Å
SCOPe Domain Sequences for d3v1wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v1wa2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} veliegerelqafeniedeikligyfknkdsehykafkeaaeefhpyipffatfdskvak kltlklneidfyeafmeepvtipdkpnseeeivnfveehrrs
Timeline for d3v1wa2: