SCOPe 2.08: Domain d3v0wl1: 3v0w L:1-107

Lineage for d3v0wl1 (3v0w L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3v0wl1: 3v0w L:1-107 [217592]
   Other proteins in same PDB: d3v0wh_, d3v0wl2
   automated match to d2aabl1
   complexed with so4

Details for d3v0wl1

PDB Entry: 3v0w, 1.73 Å

PDB Description: crystal structure of fab wn1 222-5 in complex with lps

PDB Compounds: (L:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0wl1:

Sequence; same for both SEQRES and ATOM records:

>d3v0wl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleik

Timeline for d3v0wl1:

• d3v0wl1 first appeared in SCOPe 2.03
  
• d3v0wl1 appears in SCOPe 2.07