| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3v0vl1: 3v0v L:1-107 [217590] Other proteins in same PDB: d3v0va_, d3v0vb2, d3v0vh_, d3v0vl2 automated match to d2aabl1 |
PDB Entry: 3v0v (more details), 2.13 Å
SCOPe Domain Sequences for d3v0vl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v0vl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleik
Timeline for d3v0vl1:
View in 3DDomains from other chains: (mouse over for more information) d3v0va_, d3v0vb1, d3v0vb2, d3v0vh_ |