SCOPe 2.08: Domain d3v0vb2: 3v0v B:108-212

Lineage for d3v0vb2 (3v0v B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3v0vb2: 3v0v B:108-212 [217589]
   Other proteins in same PDB: d3v0va_, d3v0vb1, d3v0vh_, d3v0vl1
   automated match to d2aabl2

Details for d3v0vb2

PDB Entry: 3v0v, 2.13 Å

PDB Description: fab wn1 222-5 unliganded

PDB Compounds: (B:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0vb2:

Sequence; same for both SEQRES and ATOM records:

>d3v0vb2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrg

Timeline for d3v0vb2:

• d3v0vb2 first appeared in SCOPe 2.03
  
• d3v0vb2 appears in SCOPe 2.07