Lineage for d3v0vb2 (3v0v B:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752779Domain d3v0vb2: 3v0v B:108-212 [217589]
    Other proteins in same PDB: d3v0va_, d3v0vb1, d3v0vh_, d3v0vl1
    automated match to d2aabl2

Details for d3v0vb2

PDB Entry: 3v0v (more details), 2.13 Å

PDB Description: fab wn1 222-5 unliganded
PDB Compounds: (B:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0vb2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrg

SCOPe Domain Coordinates for d3v0vb2:

Click to download the PDB-style file with coordinates for d3v0vb2.
(The format of our PDB-style files is described here.)

Timeline for d3v0vb2: