Lineage for d3v0vb1 (3v0v B:1-107)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (569 PDB entries)
  8. 2028690Domain d3v0vb1: 3v0v B:1-107 [217588]
    Other proteins in same PDB: d3v0vb2, d3v0vl2
    automated match to d2aabl1

Details for d3v0vb1

PDB Entry: 3v0v (more details), 2.13 Å

PDB Description: Fab WN1 222-5 unliganded
PDB Compounds: (B:) WN1 222-5 Fab (IgG2a) light chain

SCOPe Domain Sequences for d3v0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0vb1 b.1.1.0 (B:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmnqspsslsaslgdtisitcrasqniniwlswyqqkpgnvpklliykasnlhtgvps
rfsgsgsgtdftliisslqpediatyyclqgqsyprtfgggtkleik

SCOPe Domain Coordinates for d3v0vb1:

Click to download the PDB-style file with coordinates for d3v0vb1.
(The format of our PDB-style files is described here.)

Timeline for d3v0vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v0vb2