Lineage for d3v0ta1 (3v0t A:1-305)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081468Species Rauvolfia serpentina [TaxId:4060] [226312] (3 PDB entries)
  8. 2081471Domain d3v0ta1: 3v0t A:1-305 [217586]
    automated match to d3eb3a_
    complexed with atr

Details for d3v0ta1

PDB Entry: 3v0t (more details), 2.33 Å

PDB Description: Crystal Structure of Perakine Reductase, Founder Member of a Novel AKR Subfamily with Unique Conformational Changes during NADPH Binding
PDB Compounds: (A:) Perakine reductase

SCOPe Domain Sequences for d3v0ta1:

Sequence, based on SEQRES records: (download)

>d3v0ta1 c.1.7.0 (A:1-305) automated matches {Rauvolfia serpentina [TaxId: 4060]}
mprvklgtqglevsklgfgcmglsgdyndalpeeqgiavikeafncgitffdtsdiygen
gsneellgkalkqlprekiqvgtkfgiheigfsgvkakgtpdyvrscceaslkrldvdyi
dlfyihridttvpieitmgelkklveegkikyvglseaspdtirrahavhpvtalqieys
lwtrdiedeivplcrqlgigivpyspigrglfwgkaikeslpensvltshprfvgenlek
nkqiyyriealsqkhgctpvqlalawvlhqgedvvpipgttkiknlhnnvgalkvkltke
dlkei

Sequence, based on observed residues (ATOM records): (download)

>d3v0ta1 c.1.7.0 (A:1-305) automated matches {Rauvolfia serpentina [TaxId: 4060]}
mprvklgtqglevsklgfgcmglspeeqgiavikeafncgitffdtsdiygengsneell
gkalkqlprekiqvgtkfgiheigfsgvkakgtpdyvrscceaslkrldvdyidlfyihr
idttvpieitmgelkklveegkikyvglseaspdtirrahavhpvtalqieyslwtrdie
deivplcrqlgigivpyspigrglfwgkaikeyyriealsqkhgctpvqlalawvlhqge
dvvpipgttkiknlhnnvgalkvkltkedlkei

SCOPe Domain Coordinates for d3v0ta1:

Click to download the PDB-style file with coordinates for d3v0ta1.
(The format of our PDB-style files is described here.)

Timeline for d3v0ta1: