Lineage for d3v0ac_ (3v0a C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759403Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2759422Domain d3v0ac_: 3v0a C: [217584]
    automated match to d1mqkh_
    complexed with ca, mes, so4, zn

Details for d3v0ac_

PDB Entry: 3v0a (more details), 2.7 Å

PDB Description: 2.7 angstrom crystal structure of BoNT/Ai in complex with NTNHA
PDB Compounds: (C:) Llama antibody F12

SCOPe Domain Sequences for d3v0ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0ac_ b.1.1.0 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
sqvqlvesggglvqpggslrlscaasgftlgsrymswvrqapgegfewvssiepsgtawd
gdsakgrfttsrddakntlylqmsnlqpedtgvyycatgyrtdtripggswgqgtqvtv

SCOPe Domain Coordinates for d3v0ac_:

Click to download the PDB-style file with coordinates for d3v0ac_.
(The format of our PDB-style files is described here.)

Timeline for d3v0ac_: