Lineage for d3uzyb_ (3uzy B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2092401Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2092402Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2092761Protein automated matches [190169] (5 species)
    not a true protein
  7. 2092762Species Human (Homo sapiens) [TaxId:9606] [188399] (45 PDB entries)
  8. 2092798Domain d3uzyb_: 3uzy B: [217579]
    automated match to d3caqb_
    complexed with bdt, cl, nap; mutant

Details for d3uzyb_

PDB Entry: 3uzy (more details), 1.83 Å

PDB Description: crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+ and 5beta-dihydrotestosterone
PDB Compounds: (B:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3uzyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uzyb_ c.1.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiihv
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

SCOPe Domain Coordinates for d3uzyb_:

Click to download the PDB-style file with coordinates for d3uzyb_.
(The format of our PDB-style files is described here.)

Timeline for d3uzyb_: