SCOPe 2.05: Domain d3uzeb2: 3uze B:134-243

Lineage for d3uzeb2 (3uze B:134-243)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3uzeb2: 3uze B:134-243 [217573]
   Other proteins in same PDB: d3uzec_
   automated match to d1nqba2
   complexed with edo, epe, gol

Details for d3uzeb2

PDB Entry: 3uze, 2.04 Å

PDB Description: Crystal structure of the dengue virus serotype 3 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (B:) Variable domains of murine anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzeb2:

Sequence; same for both SEQRES and ATOM records:

>d3uzeb2 b.1.1.0 (B:134-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmtqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqppklliyrasnlesg
iparfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkleik

Timeline for d3uzeb2:

• d3uzeb2 first appeared in SCOPe 2.03
  
• d3uzeb2 appears in SCOPe 2.04
  
• d3uzeb2 appears in SCOPe 2.06
  
• d3uzeb2 appears in the current release, SCOPe 2.08