Lineage for d3uzeb1 (3uze B:2-117)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296945Domain d3uzeb1: 3uze B:2-117 [217572]
    automated match to d1nqba1
    complexed with edo, epe, gol

Details for d3uzeb1

PDB Entry: 3uze (more details), 2.04 Å

PDB Description: Crystal structure of the dengue virus serotype 3 envelope protein domain III in complex with the variable domains of Mab 4E11
PDB Compounds: (B:) Variable domains of murine anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uzeb1 b.1.1.0 (B:2-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsa

SCOPe Domain Coordinates for d3uzeb1:

Click to download the PDB-style file with coordinates for d3uzeb1.
(The format of our PDB-style files is described here.)

Timeline for d3uzeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uzeb2