Lineage for d1bihb2 (1bih B:99-209)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454754Protein Hemolin [49182] (1 species)
    Duplication: tandem repeat of 4 domains, known as L1 domains
  7. 454755Species Moth (Hyalophora cecropia) [TaxId:7123] [49183] (1 PDB entry)
  8. 454761Domain d1bihb2: 1bih B:99-209 [21757]

Details for d1bihb2

PDB Entry: 1bih (more details), 3.1 Å

PDB Description: crystal structure of the insect immune protein hemolin: a new domain arrangement with implications for homophilic adhesion

SCOP Domain Sequences for d1bihb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bihb2 b.1.1.4 (B:99-209) Hemolin {Moth (Hyalophora cecropia)}
yliaspakthektpiegrpfqldcvlpnaypkplitwkkrlsgadpnadvtdfdrritag
pdgnlyftivtkedvsdiykyvctaknaavdeevvlveyeikgvtkdnsgy

SCOP Domain Coordinates for d1bihb2:

Click to download the PDB-style file with coordinates for d1bihb2.
(The format of our PDB-style files is described here.)

Timeline for d1bihb2: