Lineage for d3uxnb3 (3uxn B:149-334)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1446207Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1446208Superfamily d.218.1: Nucleotidyltransferase [81301] (15 families) (S)
  5. 1446216Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 1446217Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 1446351Species Norway rat (Rattus norvegicus) [TaxId:10116] [81576] (20 PDB entries)
  8. 1446365Domain d3uxnb3: 3uxn B:149-334 [217569]
    Other proteins in same PDB: d3uxna1, d3uxna2, d3uxnb1, d3uxnb2
    automated match to d1huza4

Details for d3uxnb3

PDB Entry: 3uxn (more details), 2.5 Å

PDB Description: Crystal Structure of Rat DNA Polymerase Beta, Wild Type Apoenzyme
PDB Compounds: (B:) DNA polymerase beta

SCOPe Domain Sequences for d3uxnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxnb3 d.218.1.2 (B:149-334) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrs

SCOPe Domain Coordinates for d3uxnb3:

Click to download the PDB-style file with coordinates for d3uxnb3.
(The format of our PDB-style files is described here.)

Timeline for d3uxnb3: