Lineage for d3uxnb2 (3uxn B:92-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2325087Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2325088Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 protein domains)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2325089Protein DNA polymerase beta [81579] (2 species)
  7. 2325236Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)
  8. 2325251Domain d3uxnb2: 3uxn B:92-148 [217568]
    Other proteins in same PDB: d3uxna1, d3uxna3, d3uxnb1, d3uxnb3
    automated match to d1huza3

Details for d3uxnb2

PDB Entry: 3uxn (more details), 2.5 Å

PDB Description: Crystal Structure of Rat DNA Polymerase Beta, Wild Type Apoenzyme
PDB Compounds: (B:) DNA polymerase beta

SCOPe Domain Sequences for d3uxnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxnb2 a.60.12.1 (B:92-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d3uxnb2:

Click to download the PDB-style file with coordinates for d3uxnb2.
(The format of our PDB-style files is described here.)

Timeline for d3uxnb2: