| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (13 PDB entries) |
| Domain d3uxmd_: 3uxm D: [217563] automated match to d3hjnb_ complexed with 0dn, mg |
PDB Entry: 3uxm (more details), 1.95 Å
SCOPe Domain Sequences for d3uxmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxmd_ c.37.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnll
Timeline for d3uxmd_: