Lineage for d3uwyb_ (3uwy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078563Protein Triosephosphate isomerase [51353] (20 species)
  7. 2078739Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries)
  8. 2078747Domain d3uwyb_: 3uwy B: [217559]
    Other proteins in same PDB: d3uwya2
    automated match to d3uwva_

Details for d3uwyb_

PDB Entry: 3uwy (more details), 2.4 Å

PDB Description: Crystal structure of triosephosphate isomerase from Methicillin resistant Staphylococcus Aureus at 2.4 angstrom resolution
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3uwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uwyb_ c.1.1.1 (B:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
mrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaqg
leigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaifk
hgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgkss
tsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggasl
kvedfvqllegak

SCOPe Domain Coordinates for d3uwyb_:

Click to download the PDB-style file with coordinates for d3uwyb_.
(The format of our PDB-style files is described here.)

Timeline for d3uwyb_: