Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein Triosephosphate isomerase [51353] (20 species) |
Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries) |
Domain d3uwwa_: 3uww A: [217556] automated match to d3uwva_ complexed with 3pg, dtt, na |
PDB Entry: 3uww (more details), 2.25 Å
SCOPe Domain Sequences for d3uwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uwwa_ c.1.1.1 (A:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]} smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgks stsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggas lkvedfvqllegak
Timeline for d3uwwa_: