Lineage for d3uwqa_ (3uwq A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079288Protein automated matches [190130] (11 species)
    not a true protein
  7. 2079562Species Vibrio cholerae [TaxId:666] [226270] (1 PDB entry)
  8. 2079563Domain d3uwqa_: 3uwq A: [217552]
    automated match to d1l2ua_
    complexed with peg, pge, trs, u5p, xpe

Details for d3uwqa_

PDB Entry: 3uwq (more details), 1.8 Å

PDB Description: 1.80 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961 in complex with uridine-5'-monophosphate (ump)
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3uwqa_:

Sequence, based on SEQRES records: (download)

>d3uwqa_ c.1.2.3 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
pagseqgdqrrimtpaqaiasgsdylvigrpitqaahpevvleeinssl

Sequence, based on observed residues (ATOM records): (download)

>d3uwqa_ c.1.2.3 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
ndpkvivaldydnladalafvdkidpstcrlkvgkemftlfgpdfvrelhkrgfsvfldl
kfhdipntcskavkaaaelgvwmvnvhasggermmaasreilepygkerplligvtvlts
mesadlqgigilsapqdhvlrlatltknagldgvvcsaqeasllkqhlgrefklvtpgir
parrimtpaqaiasgsdylvigrpitqaahpevvleeinssl

SCOPe Domain Coordinates for d3uwqa_:

Click to download the PDB-style file with coordinates for d3uwqa_.
(The format of our PDB-style files is described here.)

Timeline for d3uwqa_: