Lineage for d3uw8b2 (3uw8 B:424-731)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720495Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2720496Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2720695Species Haloarcula marismortui [TaxId:272569] [226537] (1 PDB entry)
  8. 2720697Domain d3uw8b2: 3uw8 B:424-731 [217548]
    Other proteins in same PDB: d3uw8a1, d3uw8a2
    automated match to d1itka2
    complexed with hem

Details for d3uw8b2

PDB Entry: 3uw8 (more details), 2.35 Å

PDB Description: Crystal Structure Analysis of the Ser305Thr Variants of KatG from Haloarcula marismortui
PDB Compounds: (B:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3uw8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uw8b2 a.93.1.3 (B:424-731) Catalase-peroxidase KatG {Haloarcula marismortui [TaxId: 272569]}
deemiwqdplpdadydligdeeiaelkeeildsdlsvsqlvktawasastyrdsdkrgga
ngarlrlepqknwevnepeqletvlgtleniqtefndsrsdgtqvsladlivlggnaave
qaaanagydveipfepgrvdagpehtdapsfdalkpkvdgvrnyiqdditrpaeevlvdn
adllnltaseltaliggmrsiganyqdtdlgvftdepetltndffvnlldmgtewepaad
sehrykgldrdtgevkweatridlifgsndrlraisevygsadaekklvhdfvdtwskvm
kldrfdle

SCOPe Domain Coordinates for d3uw8b2:

Click to download the PDB-style file with coordinates for d3uw8b2.
(The format of our PDB-style files is described here.)

Timeline for d3uw8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uw8b1