SCOPe 2.03: Domain d3uw8a1: 3uw8 A:18-423

Lineage for d3uw8a1 (3uw8 A:18-423)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (8 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:272569] [226809] (7 PDB entries)

8. Domain d3uw8a1: 3uw8 A:18-423 [217545]
   Other proteins in same PDB: d3uw8b1, d3uw8b2
   automated match to d1ub2a1
   complexed with hem

Details for d3uw8a1

PDB Entry: 3uw8, 2.35 Å

PDB Description: Crystal Structure Analysis of the Ser305Thr Variants of KatG from Haloarcula marismortui

PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3uw8a1:

Sequence; same for both SEQRES and ATOM records:

>d3uw8a1 a.93.1.0 (A:18-423) automated matches {Haloarcula marismortui [TaxId: 272569]}
krpksnqdwwpsklnleildqnardvgpveddfdyaeefqkldleavksdleelmtssqd
wwpadyghygplfirmawhsagtyrtadgrggaaggrqrfapinswpdnanldkarrlll
pikqkygqkiswadlmilagnvaiesmgfktfgyaggredafeedkavnwgpedefetqe
rfdepgeiqeglgasvmgliyvnpegpdgnpdpeasaknirqtfdrmamndketaaliag
ghtfgkvhgaddpeenlgpepeaapieqqglgwqnkngnskggemittgiegpwtqspte
wdmgyinnlldyewepekgpggawqwapkseelknsvpdahdpdekqtpmmlttdialkr
dpdyrevmetfqenpmefgmnfakawyklthrdmgpperflgpevp

Timeline for d3uw8a1:

• d3uw8a1 is new in SCOPe 2.03-stable
  
• d3uw8a1 appears in SCOPe 2.04
  
• d3uw8a1 appears in the current release, SCOPe 2.08