Lineage for d3uvtb1 (3uvt B:323-428)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879703Domain d3uvtb1: 3uvt B:323-428 [217541]
    Other proteins in same PDB: d3uvta2, d3uvtb2, d3uvtc2, d3uvtd2
    automated match to d2vm1a_
    complexed with so4

Details for d3uvtb1

PDB Entry: 3uvt (more details), 2 Å

PDB Description: Crystal structure of the third catalytic domain of ERp46
PDB Compounds: (B:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3uvtb1:

Sequence, based on SEQRES records: (download)

>d3uvtb1 c.47.1.0 (B:323-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvkiaevdct
aernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

Sequence, based on observed residues (ATOM records): (download)

>d3uvtb1 c.47.1.0 (B:323-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpgagvkiaevdcta
ernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

SCOPe Domain Coordinates for d3uvtb1:

Click to download the PDB-style file with coordinates for d3uvtb1.
(The format of our PDB-style files is described here.)

Timeline for d3uvtb1: