SCOPe 2.08: Domain d3uvtb1: 3uvt B:323-428

Lineage for d3uvtb1 (3uvt B:323-428)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d3uvtb1: 3uvt B:323-428 [217541]
   Other proteins in same PDB: d3uvta2, d3uvtb2, d3uvtc2, d3uvtd2
   automated match to d2vm1a_
   complexed with so4

Details for d3uvtb1

PDB Entry: 3uvt, 2 Å

PDB Description: Crystal structure of the third catalytic domain of ERp46

PDB Compounds: (B:) Thioredoxin domain-containing protein 5

SCOPe Domain Sequences for d3uvtb1:

Sequence, based on SEQRES records:

>d3uvtb1 c.47.1.0 (B:323-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvkiaevdct
aernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

Sequence, based on observed residues (ATOM records):

>d3uvtb1 c.47.1.0 (B:323-428) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpgagvkiaevdcta
ernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqa

Timeline for d3uvtb1:

• d3uvtb1 first appeared in SCOPe 2.03, called d3uvtb_
  
• d3uvtb1 appears in SCOPe 2.07