Lineage for d3uvjb_ (3uvj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954779Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954860Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2954861Protein automated matches [191274] (13 species)
    not a true protein
  7. 2954891Species Human (Homo sapiens) [TaxId:9606] [225808] (3 PDB entries)
  8. 2954895Domain d3uvjb_: 3uvj B: [217535]
    automated match to d2gvzb1
    complexed with edo, gol

Details for d3uvjb_

PDB Entry: 3uvj (more details), 2.08 Å

PDB Description: crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.
PDB Compounds: (B:) guanylate cyclase soluble subunit beta-1

SCOPe Domain Sequences for d3uvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uvjb_ d.58.29.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pakrydnvtilfsgivgfnafcskhasgegamkivnllndlytrfdtltdsrknpfvykv
etvcdkymtvsglpepcihharsichlaldmmeiagqvqvdgesvqitigihtgevvtgv
igqrmpryslfgntvnltsrtettgekgkinvseytyrclmspensdpqfhlehrgpvsm
kgkkepmqvwflsrkn

SCOPe Domain Coordinates for d3uvjb_:

Click to download the PDB-style file with coordinates for d3uvjb_.
(The format of our PDB-style files is described here.)

Timeline for d3uvjb_: