SCOPe 2.08: Domain d3uvjb_: 3uvj B:

Lineage for d3uvjb_ (3uvj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.0: automated matches [191671] (1 protein)
   not a true family

6. Protein automated matches [191274] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225808] (3 PDB entries)

8. Domain d3uvjb_: 3uvj B: [217535]
   automated match to d2gvzb1
   complexed with edo, gol

Details for d3uvjb_

PDB Entry: 3uvj, 2.08 Å

PDB Description: crystal structure of the catalytic domain of the heterodimeric human soluble guanylate cyclase 1.

PDB Compounds: (B:) guanylate cyclase soluble subunit beta-1

SCOPe Domain Sequences for d3uvjb_:

Sequence; same for both SEQRES and ATOM records:

>d3uvjb_ d.58.29.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pakrydnvtilfsgivgfnafcskhasgegamkivnllndlytrfdtltdsrknpfvykv
etvcdkymtvsglpepcihharsichlaldmmeiagqvqvdgesvqitigihtgevvtgv
igqrmpryslfgntvnltsrtettgekgkinvseytyrclmspensdpqfhlehrgpvsm
kgkkepmqvwflsrkn

Timeline for d3uvjb_:

• d3uvjb_ first appeared in SCOPe 2.03
  
• d3uvjb_ appears in SCOPe 2.07