Lineage for d3uvha2 (3uvh A:92-241)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492203Protein automated matches [226848] (10 species)
    not a true protein
  7. 1492217Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)
  8. 1492301Domain d3uvha2: 3uvh A:92-241 [217532]
    Other proteins in same PDB: d3uvha1, d3uvhb1
    automated match to d1k0ma1
    mutant

Details for d3uvha2

PDB Entry: 3uvh (more details), 1.84 Å

PDB Description: Crystal Structure Analysis of E81M mutant of human CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3uvha2:

Sequence, based on SEQRES records: (download)

>d3uvha2 a.45.1.1 (A:92-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d3uvha2 a.45.1.1 (A:92-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayaree
fastcpddeeielayeqvakalk

SCOPe Domain Coordinates for d3uvha2:

Click to download the PDB-style file with coordinates for d3uvha2.
(The format of our PDB-style files is described here.)

Timeline for d3uvha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uvha1