SCOPe 2.07: Domain d3utze2: 3utz E:113-216

Lineage for d3utze2 (3utz E:113-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3utze2: 3utz E:113-216 [217528]
   Other proteins in same PDB: d3utza1, d3utzd1, d3utze1
   automated match to d1blna2
   complexed with so4

Details for d3utze2

PDB Entry: 3utz, 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential

PDB Compounds: (E:) Metalloproteinase, light chain

SCOPe Domain Sequences for d3utze2:

Sequence; same for both SEQRES and ATOM records:

>d3utze2 b.1.1.0 (E:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3utze2:

• d3utze2 first appeared in SCOPe 2.03
  
• d3utze2 appears in SCOPe 2.06
  
• d3utze2 appears in the current release, SCOPe 2.08