![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (22 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
![]() | Domain d3utze1: 3utz E:2-112 [217527] Other proteins in same PDB: d3utza2, d3utzd2, d3utze2 automated match to d1blna1 complexed with so4 |
PDB Entry: 3utz (more details), 2.18 Å
SCOPe Domain Sequences for d3utze1:
Sequence, based on SEQRES records: (download)
>d3utze1 b.1.1.1 (E:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrfs gvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleik
>d3utze1 b.1.1.1 (E:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vlmtqtplslpvslgdqasiscrssqsivhgntflewylqkpgqspklliykvsnrfsgv pdrfsgsggtdftlkisrveaedlgvyycfqashvpptfgsgtkleik
Timeline for d3utze1:
![]() Domains from other chains: (mouse over for more information) d3utza1, d3utza2, d3utzd1, d3utzd2 |