Lineage for d3utze1 (3utz E:2-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290012Species Escherichia coli [TaxId:562] [225179] (4 PDB entries)
  8. 1290015Domain d3utze1: 3utz E:2-112 [217527]
    Other proteins in same PDB: d3utza2, d3utzd2, d3utze2
    automated match to d1blna1
    complexed with so4

Details for d3utze1

PDB Entry: 3utz (more details), 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
PDB Compounds: (E:) metalloproteinase

SCOPe Domain Sequences for d3utze1:

Sequence, based on SEQRES records: (download)

>d3utze1 b.1.1.1 (E:2-112) automated matches {Escherichia coli [TaxId: 562]}
vlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleik

Sequence, based on observed residues (ATOM records): (download)

>d3utze1 b.1.1.1 (E:2-112) automated matches {Escherichia coli [TaxId: 562]}
vlmtqtplslpvslgdqasiscrssqsivhgntflewylqkpgqspklliykvsnrfsgv
pdrfsgsggtdftlkisrveaedlgvyycfqashvpptfgsgtkleik

SCOPe Domain Coordinates for d3utze1:

Click to download the PDB-style file with coordinates for d3utze1.
(The format of our PDB-style files is described here.)

Timeline for d3utze1: