SCOPe 2.06: Domain d3utzd1: 3utz D:2-112

Lineage for d3utzd1 (3utz D:2-112)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d3utzd1: 3utz D:2-112 [217525]
   Other proteins in same PDB: d3utza2, d3utzd2, d3utze2
   automated match to d1blna1
   complexed with so4

Details for d3utzd1

PDB Entry: 3utz, 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential

PDB Compounds: (D:) metalloproteinase

SCOPe Domain Sequences for d3utzd1:

Sequence, based on SEQRES records:

>d3utzd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleik

Sequence, based on observed residues (ATOM records):

>d3utzd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlmtqtplslpvslgdqasiscrssqsingntflewylqkpgqspklliykvsnrfsgvp
drfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleik

Timeline for d3utzd1:

• d3utzd1 first appeared in SCOPe 2.03
  
• d3utzd1 appears in SCOPe 2.05
  
• d3utzd1 appears in SCOPe 2.07
  
• d3utzd1 appears in the current release, SCOPe 2.08