![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries) |
![]() | Domain d3utza2: 3utz A:113-216 [217524] Other proteins in same PDB: d3utza1, d3utzd1, d3utze1 automated match to d1blna2 complexed with so4 |
PDB Entry: 3utz (more details), 2.18 Å
SCOPe Domain Sequences for d3utza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3utza2 b.1.1.0 (A:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3utza2:
![]() Domains from other chains: (mouse over for more information) d3utzd1, d3utzd2, d3utze1, d3utze2 |