Lineage for d3utza2 (3utz A:113-216)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520862Domain d3utza2: 3utz A:113-216 [217524]
    Other proteins in same PDB: d3utza1, d3utzd1, d3utze1
    automated match to d1blna2
    complexed with so4

Details for d3utza2

PDB Entry: 3utz (more details), 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential
PDB Compounds: (A:) metalloproteinase

SCOPe Domain Sequences for d3utza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utza2 b.1.1.0 (A:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d3utza2:

Click to download the PDB-style file with coordinates for d3utza2.
(The format of our PDB-style files is described here.)

Timeline for d3utza2: