SCOPe 2.08: Domain d3utza1: 3utz A:2-112

Lineage for d3utza1 (3utz A:2-112)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
Domain d3utza1: 3utz A:2-112 [217523]
Other proteins in same PDB: d3utza2, d3utzd2, d3utze2
automated match to d1blna1
complexed with so4

Details for d3utza1

PDB Entry: 3utz (more details), 2.18 Å

PDB Description: endogenous-like inhibitory antibodies targeting activated metalloproteinase motifs show therapeutic potential

PDB Compounds: (A:) Metalloproteinase, light chain

SCOPe Domain Sequences for d3utza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utza1 b.1.1.1 (A:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlmtqtplslpvslgdqasiscrssqsivhsngntflewylqkpgqspklliykvsnrfs
gvpdrfsgsgsgtdftlkisrveaedlgvyycfqashvpptfgsgtkleik

SCOPe Domain Coordinates for d3utza1:

Click to download the PDB-style file with coordinates for d3utza1.
(The format of our PDB-style files is described here.)

Timeline for d3utza1: