Lineage for d3utpl1 (3utp L:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367093Domain d3utpl1: 3utp L:1-117 [217521]
    Other proteins in same PDB: d3utpd2, d3utpe2, d3utpk2, d3utpl2
    automated match to d1ktke1
    complexed with btb, gol, so4

Details for d3utpl1

PDB Entry: 3utp (more details), 2.57 Å

PDB Description: 1e6 tcr specific for hla-a*0201-alwgpdpaaa
PDB Compounds: (L:) 1E6 TCR Beta Chain

SCOPe Domain Sequences for d3utpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utpl1 b.1.1.0 (L:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dagviqsprhevtemgqqvtlrckpisghdylfwyrqtmmrglelliyfnnnvpiddsgm
pedrfsakmpnasfstlkiqpseprdsavyfcasslweklakniqyfgagtrlsvle

SCOPe Domain Coordinates for d3utpl1:

Click to download the PDB-style file with coordinates for d3utpl1.
(The format of our PDB-style files is described here.)

Timeline for d3utpl1: