SCOPe 2.06: Domain d3utpe2: 3utp E:118-246

Lineage for d3utpe2 (3utp E:118-246)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d3utpe2: 3utp E:118-246 [217518]
   Other proteins in same PDB: d3utpd1, d3utpe1, d3utpk1, d3utpl1
   automated match to d1ktke2
   complexed with btb, gol, so4

Details for d3utpe2

PDB Entry: 3utp, 2.57 Å

PDB Description: 1e6 tcr specific for hla-a*0201-alwgpdpaaa

PDB Compounds: (E:) 1E6 TCR Beta Chain

SCOPe Domain Sequences for d3utpe2:

Sequence; same for both SEQRES and ATOM records:

>d3utpe2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3utpe2:

• d3utpe2 first appeared in SCOPe 2.03
  
• d3utpe2 appears in SCOPe 2.05
  
• d3utpe2 appears in SCOPe 2.07
  
• d3utpe2 appears in the current release, SCOPe 2.08