Lineage for d3utpe2 (3utp E:118-246)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750764Domain d3utpe2: 3utp E:118-246 [217518]
    Other proteins in same PDB: d3utpd1, d3utpe1, d3utpk1, d3utpl1
    automated match to d1ktke2
    complexed with btb, gol, so4

Details for d3utpe2

PDB Entry: 3utp (more details), 2.57 Å

PDB Description: 1e6 tcr specific for hla-a*0201-alwgpdpaaa
PDB Compounds: (E:) 1E6 TCR Beta Chain

SCOPe Domain Sequences for d3utpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utpe2 b.1.1.2 (E:118-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3utpe2:

Click to download the PDB-style file with coordinates for d3utpe2.
(The format of our PDB-style files is described here.)

Timeline for d3utpe2: