SCOPe 2.08: Domain d3utpe1: 3utp E:1-117

Lineage for d3utpe1 (3utp E:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3utpe1: 3utp E:1-117 [217517]
   Other proteins in same PDB: d3utpd2, d3utpe2, d3utpk2, d3utpl2
   automated match to d1ktke1
   complexed with btb, gol, so4

Details for d3utpe1

PDB Entry: 3utp, 2.57 Å

PDB Description: 1e6 tcr specific for hla-a*0201-alwgpdpaaa

PDB Compounds: (E:) 1E6 TCR Beta Chain

SCOPe Domain Sequences for d3utpe1:

Sequence; same for both SEQRES and ATOM records:

>d3utpe1 b.1.1.0 (E:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dagviqsprhevtemgqqvtlrckpisghdylfwyrqtmmrglelliyfnnnvpiddsgm
pedrfsakmpnasfstlkiqpseprdsavyfcasslweklakniqyfgagtrlsvle

Timeline for d3utpe1:

• d3utpe1 first appeared in SCOPe 2.03
  
• d3utpe1 appears in SCOPe 2.07