Lineage for d3utpd1 (3utp D:2-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765889Domain d3utpd1: 3utp D:2-112 [217515]
    Other proteins in same PDB: d3utpd2, d3utpe2, d3utpk2, d3utpl2
    automated match to d1qrnd1
    complexed with btb, gol, so4

Details for d3utpd1

PDB Entry: 3utp (more details), 2.57 Å

PDB Description: 1e6 tcr specific for hla-a*0201-alwgpdpaaa
PDB Compounds: (D:) 1E6 TCR Alpha Chain

SCOPe Domain Sequences for d3utpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3utpd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keveqdpgplsvpegaivslnctysnsafqyfmwyrqysrkgpellmytyssgnkedgrf
taqvdksskyislfirdsqpsdsatylcamrgdssyklifgsgtrllvrpd

SCOPe Domain Coordinates for d3utpd1:

Click to download the PDB-style file with coordinates for d3utpd1.
(The format of our PDB-style files is described here.)

Timeline for d3utpd1: