Lineage for d3ut6a_ (3ut6 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375290Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)
  7. 1375347Species Escherichia coli [TaxId:562] [53172] (24 PDB entries)
  8. 1375348Domain d3ut6a_: 3ut6 A: [217512]
    automated match to d1k9sa_
    complexed with fmc, po4

Details for d3ut6a_

PDB Entry: 3ut6 (more details), 1.9 Å

PDB Description: crystal structure of e. coli pnp complexed with po4 and formycin a
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3ut6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ut6a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Escherichia coli [TaxId: 562]}
atphinaemgdfadvvlmpgdplrakyiaetfledarevnnvrgmlgftgtykgrkisvm
ghgmgipscsiytkelitdfgvkkiirvgscgavlphvklrdvvigmgactdskvnrirf
kdhdfaaiadfdmvrnavdaakalgidarvgnlfsadlfyspdgemfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtheqttaaerqttfndmikialesvllgdk

SCOPe Domain Coordinates for d3ut6a_:

Click to download the PDB-style file with coordinates for d3ut6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ut6a_: