Lineage for d3ut2a2 (3ut2 A:476-784)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275305Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1275306Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1275879Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 1275880Protein automated matches [191104] (8 species)
    not a true protein
  7. 1275908Species Magnaporthe oryzae [TaxId:242507] [226424] (1 PDB entry)
  8. 1275910Domain d3ut2a2: 3ut2 A:476-784 [217509]
    automated match to d1ub2a2
    complexed with hem

Details for d3ut2a2

PDB Entry: 3ut2 (more details), 1.55 Å

PDB Description: crystal structure of fungal magkatg2
PDB Compounds: (A:) Catalase-peroxidase 2

SCOPe Domain Sequences for d3ut2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ut2a2 a.93.1.0 (A:476-784) automated matches {Magnaporthe oryzae [TaxId: 242507]}
kesfiwqdplparegdliddadvdklkaailstdgldvsklastamacattyrnsdkrgg
cngarialepqrnwvsnnptqlsavldalkkvqsdfngsngnkkvsladlivlggtaave
kaakdagvdikvpfsagrvdatqeqtdvtqfsylepqadgfrnygrgtararteeimvdk
asqltltppeltvlvggmralganydgsdvgvftankgkltpdffvnlvdmniawtasga
dgeswvgtdrksrsekykgsradlvfgshaelraiaevyaengnqekfvkdfvaawtkvm
nldrfdlkv

SCOPe Domain Coordinates for d3ut2a2:

Click to download the PDB-style file with coordinates for d3ut2a2.
(The format of our PDB-style files is described here.)

Timeline for d3ut2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ut2a1